Polypeptide MELO3C000465P1
Accession: MELO3C000465P1
Name: MELO3C000465P1
Description: Similar to Adenylyl-sulfate kinase 1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q43295|KAP1_ARATH)
Sequence:
>MELO3C000465P1 Similar to Adenylyl-sulfate kinase 1, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q43295|KAP1_ARATH) MGKLAYILDGDNVRHGLNRDLGFKAEDRAENIRRVGEVAKLFTDAGVICIASVISPYRRDRDVCRAILPDGYFIE
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: ATP + sulfate => adenylyl sulfate (APS) + pyrophosphate (REACT_106092), adenylyl sulfate (APS) + ATP => PAPS + ADP (REACT_77274).
REACTOME_PATHWAY: Phase II conjugation (REACT_110771), Cytosolic sulfonation of small molecules (REACT_29071), Biological oxidations (REACT_110034), Formation of PAPS (REACT_107642).
biological_process: 3'-phosphoadenosine 5'-phosphosulfate metabolic process, 3'-phosphoadenosine 5'-phosphosulfate biosynthetic process, xenobiotic metabolic process.
These properties come from blast2go analysis
molecular_function: oxidoreductase activity, ATP binding, protein binding, signal transducer activity, adenylylsulfate kinase activity.
cellular_component: chloroplast.
biological_process: oxidation-reduction process, cysteine biosynthetic process, response to light stimulus, sulfate assimilation.
This polypeptide in other databases
In PhylomeDB is Phy003LHXC_CUCME .
