Polypeptide MELO3C000579P1
Accession: MELO3C000579P1
Name: MELO3C000579P1
Description: Similar to Bcr-associated protein, bap, putative (Ricinus communis) (uniref90:UniRef90_B9S4Z8)
Sequence:
>MELO3C000579P1 Similar to Bcr-associated protein, bap, putative (Ricinus communis) (uniref90:UniRef90_B9S4Z8) IGLLRAFVIKILDQLKMGKGPATVKTIAATMSVILLSSLMNVVKIQNKGAKLGTMSPIDQ
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: receptor activity.
cellular_component: cytoplasmic membrane-bounded vesicle, integral to membrane, endoplasmic reticulum.
biological_process: intracellular protein transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MJP0_CUCME .
