Polypeptide MELO3C000666P1

Accession: MELO3C000666P1

Name: MELO3C000666P1

Description: Similar to Beta-galactosidase 12 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SCV0|BGA12_ARATH)

Sequence:

>MELO3C000666P1 Similar to Beta-galactosidase 12 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SCV0|BGA12_ARATH)
TTFNTPTGNEPLALDMSSMSKGQIWVNGRSIGRYFPGYIANGKCNKCSYTGFFTEKKCLWNCGGPSQK

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: cation binding, sugar binding, beta-galactosidase activity.

biological_process: carbohydrate metabolic process.

These properties come from phylome analysis


molecular_function: hydrolase activity, hydrolyzing O-glycosyl compounds, sugar binding.

biological_process: carbohydrate metabolic process.

Partial gene: true

Locations

Located in CM3.5_contig34861 from 164 to 369.

This polypeptide in other databases

In PhylomeDB is Phy003MDX3_CUCME .

Related features