Polypeptide MELO3C000682P1
Accession: MELO3C000682P1
Name: MELO3C000682P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_52.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQ60)
Sequence:
>MELO3C000682P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_52.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQ60) MSQYNEKDSRNMEACGWDDDFWEEIGLRDLVDGHHAKIGRSVAFPGHPLGSGLTPVAAK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: carbohydrate kinase activity, phosphotransferase activity, alcohol group as acceptor.
biological_process: carbohydrate metabolic process.
This polypeptide in other databases
In PhylomeDB is Phy003LICC_CUCME .