Polypeptide MELO3C001305P1
Accession: MELO3C001305P1
Name: MELO3C001305P1
Description: Similar to 26S protease regulatory subunit 8 homolog B (Arabidopsis thaliana) (uniprot_sprot:sp|Q94BQ2|PRS8B_ARATH)
Sequence:
>MELO3C001305P1 Similar to 26S protease regulatory subunit 8 homolog B (Arabidopsis thaliana) (uniprot_sprot:sp|Q94BQ2|PRS8B_ARATH) MRGIDLKGIAEKMNGASGAEVKAVCTEVGMFALRERRVHVTQEDFEMAIAK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: microtubule-severing ATPase activity, peptidase activity, ATP binding.
cellular_component: cytoplasm, nucleus, proteasome complex.
biological_process: ubiquitin-dependent protein catabolic process.
This polypeptide in other databases
In PhylomeDB is Phy003MIY8_CUCME .
