Polypeptide MELO3C001566P1
Accession: MELO3C001566P1
Name: MELO3C001566P1
Description: Similar to ATP synthase subunit c, chloroplastic (Trachelium caeruleum) (uniprot_sprot:sp|A9QC36|ATPH_TRACE)
Sequence:
>MELO3C001566P1 Similar to ATP synthase subunit c, chloroplastic (Trachelium caeruleum) (uniprot_sprot:sp|A9QC36|ATPH_TRACE) ELIMNPLISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLL
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: hydrogen ion transporting ATP synthase activity, rotational mechanism, lipid binding.
cellular_component: proton-transporting ATP synthase complex, coupling factor F(o), cytoplasmic membrane-bounded vesicle, integral to membrane, chloroplast thylakoid membrane.
biological_process: ATP synthesis coupled proton transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MDBX_CUCME .
