Polypeptide MELO3C001623P1
Accession: MELO3C001623P1
Name: MELO3C001623P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_134.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQP7)
Sequence:
>MELO3C001623P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_134.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQP7) KNKRLWSSNDWKKKLSSFINFFQSIRDLGLLHNHTKVICVSAGAGHEVMALSHMGVHDVTGVELIDSPPL
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: methyltransferase activity.
biological_process: metabolic process.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MGTW_CUCME .