Polypeptide MELO3C002268P2

Accession: MELO3C002268P2

Name: MELO3C002268P2

Description: Similar to Iron sulfur cluster assembly protein 1, mitochondrial (Kluyveromyces lactis) (uniprot_sprot:sp|Q6CRQ9|ISU1_KLULA)

Sequence:

>MELO3C002268P2 Similar to Iron sulfur cluster assembly protein 1, mitochondrial (Kluyveromyces lactis) (uniprot_sprot:sp|Q6CRQ9|ISU1_KLULA)
MLRFSSKRLLGIASRDLPSPAVQIVPRFYHERVIDHYNNPRNVGSFDKNDPTVGTGLVGAPACGDVMKLQIKVDEKTGKV
VDACFKTFGCGSAIASSSLATEMVKGKQMEEALTIKNSEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRAKLANGAE
SSSVEKASNA*

Download fasta sequence.

Properties

These properties come from kegg analysis


COG: NifU homolog involved in Fe-S cluster formation (COG0822).

These properties come from phylome analysis


molecular_function: protein complex scaffold, iron-sulfur cluster binding, protein binding, iron ion binding.

cellular_component: cytosol, nucleus, mitochondrion.

biological_process: growth, embryo development ending in birth or egg hatching, nitrogen fixation, nematode larval development, iron-sulfur cluster assembly.

These properties come from blast2go analysis


molecular_function: iron-sulfur cluster binding, protein binding, iron ion binding.

cellular_component: mitochondrion.

biological_process: iron-sulfur cluster assembly.

Locations

Located in CM3.5_scaffold00001 from 2339571 to 2341872.

This polypeptide in other databases

In PhylomeDB is Phy003ABXH_CUCME .

Related features