Polypeptide MELO3C002478P1
Accession: MELO3C002478P1
Name: MELO3C002478P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_116.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_E0CVL8)
Sequence:
>MELO3C002478P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_116.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_E0CVL8) MSNKLKGIYKSFKYISQIFVMKEREMEIGYPTDVKHVAHIGWDGPSGTAPSWVSDLHHHLVSNIFTFFSSFFSVCTILLS GCFKIFPWFW*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: Rab GTPase activator activity.
cellular_component: membrane, intracellular.
biological_process: regulation of Rab GTPase activity.
This polypeptide in other databases
In PhylomeDB is Phy003MGQ6_CUCME .
