Polypeptide MELO3C004539P1

Accession: MELO3C004539P1

Name: MELO3C004539P1

Description: Similar to Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' iota isoform (Arabidopsis thaliana) (uniprot_sprot:sp|Q93YV6|2A5I_ARATH)

Sequence:

>MELO3C004539P1 Similar to Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' iota isoform (Arabidopsis thaliana) (uniprot_sprot:sp|Q93YV6|2A5I_ARATH)
MLKQILSKLPKKLQKSETVDSATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSSAVFPASIAAEAVDPHLSFKDVP
NPQKQNLFVSKLNYCCEVFDLNDMEKQDLKRQMLIDVVDFVTSGSAKFTETAISSVCKLCAANLFRVFPPKSRSTSTGGE
TEDEEPIFDPAWSHLQNVYDLLLHFVSSNSLDAKVAKKYLDHSFILRLLDLFDSDDPRERDCLKTILHRVYGKFMIHRPF
IRKAISNVMYRFVFETERHNGIAELLEIFGSVITGFALPLKEEHKTFLWRVLIPLHKPKSVGIYHQQLTYCIVQFIDKDP
KLASTVIKGLLRYWPLTNSQKELMFLSETEEILEMISMVEFQKIMVPLFRRIGYCLNSSHYQVAEKAHLLWNNEHIINLI
GHNRQAIIPIIIPALERNTQKHWNNAVLNLTLNVKKLVHEMDEELVLACQVDLKEEQSRSVAAAEKRRLTWERLENAARP
QPISPNISFLVEPATCAVAG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: protein phosphatase type 2A regulator activity.

cellular_component: protein phosphatase type 2A complex.

biological_process: signal transduction.

These properties come from reactome analysis


REACTOME_REACTION: Dephosphorylation of pChREBP (Ser 568) by PP2A (REACT_814), CTLA-4 binds B7-1/B7-2 (REACT_19129), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_9977), ERKs are inactivated by protein phosphatase 2A (REACT_12539), Kinetochore capture of astral microtubules (REACT_14798), ERKs are inactivated by protein phosphatase 2A (REACT_94309), Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_31296), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_10127), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_9978), Dephosphorylation of pChREBP (Thr 666) by PP2A (REACT_382), Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_9959), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_95437), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_31397), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_109807), Phosphorylation of APC component of the destruction complex (REACT_90760), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_98708), Dephosphorylation of pChREBP (Ser 196) by PP2A (REACT_1416), Phosphorylation of CTLA-4 (REACT_19380), PP2A binds CTLA4 homodimer (REACT_19404), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_9987), Phosphorylation of APC component of the destruction complex (REACT_101170), Dephosphorylation of phosphoPFKFB1 by PP2A complex (REACT_1347), Phosphorylation of APC component of the destruction complex (REACT_9983), Dephosphorylation of AKT by PP2A (REACT_95082), Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_105345), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_34050), Dephosphorylation of AKT by PP2A (REACT_19209), Assembly of the destruction complex (REACT_10134), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_10082), Activation of PP2A by Xylulose-5-phosphate (REACT_95404), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_31799), Activation of PP2A by Xylulose-5-phosphate (REACT_2177), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_81693), Association of beta-catenin with the destruction complex (REACT_10111), DARPP-32 is dephosphorylated on Thr75 by PP2A (REACT_15438), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_9955), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_87315), Dephosphorylation of phosphoPFKFB1 by PP2A complex (REACT_86836), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_87470), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_88742), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_101640), PECAM-1 binds PP2A (REACT_23942), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_88235), Association of beta-catenin with the destruction complex (REACT_78431).

biological_process: carbohydrate metabolic process, stress-activated MAPK cascade, innate immune response, mitotic cell cycle, glycolysis, toll-like receptor 1 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 3 signaling pathway, T cell costimulation, toll-like receptor signaling pathway, MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, glucose metabolic process, nerve growth factor receptor signaling pathway, mitotic prometaphase, toll-like receptor 4 signaling pathway, energy reserve metabolic process, platelet activation, Toll signaling pathway, blood coagulation, M phase of mitotic cell cycle.

REACTOME_COMPLEX: PP2A-ABdeltaC complex [nucleoplasm] (REACT_2369), Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10218), Microtubule-bound kinetochore [cytosol] (REACT_15175), phospho-(Ser45, Thr41) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10844), SCF-beta-TrCP1 complex associated with phosphorylated beta-catenin [cytosol] (REACT_10593), phospho-(Ser45, Thr41, Ser37) beta-catenin:Axin,GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10861), ubiquitinated phospho-beta-catenin:SCF:beta-TrCP1 complex [cytosol] (REACT_10202), p-PECAM:PP2A [plasma membrane] (REACT_24470), PP2A-ABdeltaC complex [cytosol] (REACT_5648), Kinetochore [cytosol] (REACT_14970), Phospho-(Ser45, Thr41, Ser37, Ser33) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10610), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10886), PP2A:CTLA4:B7-1/B7-2 [plasma membrane] (REACT_19452), beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10837), CTLA-4:PP2A [plasma membrane] (REACT_19731), phospho-(Ser45) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10809), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10381), Inactive PP2A-ABdeltaC complex [cytosol] (REACT_4092), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10660), PP2A [cytosol] (REACT_10628).

REACTOME_PATHWAY: PP2A-mediated dephosphorylation of key metabolic factors (REACT_705), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), DNA Replication (REACT_383), Signaling by Wnt (REACT_82742), ERK/MAPK targets (REACT_12599), MAP kinase activation in TLR cascade (REACT_82500), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_95028), MAP kinase activation in TLR cascade (REACT_21308), MyD88:Mal cascade initiated on plasma membrane (REACT_92018), Mitotic M-M/G1 phases (REACT_21300), Toll Like Receptor TLR6:TLR2 Cascade (REACT_106218), Costimulation by the CD28 family (REACT_19344), NGF signalling via TRKA from the plasma membrane (REACT_12056), Toll Like Receptor 10 (TLR10) Cascade (REACT_92313), Metabolism of carbohydrates (REACT_474), ERK/MAPK targets (REACT_31447), Nuclear Events (kinase and transcription factor activation) (REACT_12433), ERKs are inactivated (REACT_12436), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), DARPP-32 events (REACT_15334), Glycolysis (REACT_104018), Hemostasis (REACT_604), Platelet Activation (REACT_798), Metabolism of carbohydrates (REACT_106046), Toll Receptor Cascades (REACT_6966), Mitotic Prometaphase (REACT_682), Beta-catenin phosphorylation cascade (REACT_102439), Cell Cycle, Mitotic (REACT_152), Toll Like Receptor 4 (TLR4) Cascade (REACT_109895), Degradation of beta-catenin by the destruction complex (REACT_89447), Toll Like Receptor 2 Cascade (REACT_109018), Platelet homeostasis (REACT_23876), Toll Receptor Cascades (REACT_91529), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91838), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_21328), Platelet sensitization by LDL (REACT_23879), Signaling by Wnt (REACT_11045), Costimulation by the CD28 family (REACT_34799), Immune System (REACT_6900), ERKs are inactivated (REACT_84521), MyD88 cascade initiated on plasma membrane (REACT_27215), Integration of energy metabolism (REACT_1505), Toll Like Receptor 5 (TLR5) Cascade (REACT_30810), PP2A-mediated dephosphorylation of key metabolic factors (REACT_105036), Toll Like Receptor 2 Cascade (REACT_7980), Signalling by NGF (REACT_11061), Degradation of beta-catenin by the destruction complex (REACT_11063), Beta-catenin phosphorylation cascade (REACT_11065), Glucose metabolism (REACT_30754), Signaling by Wnt (REACT_89971), Toll Like Receptor 9 (TLR9) Cascade (REACT_32391), NGF signalling via TRKA from the plasma membrane (REACT_29880), Adaptive Immunity Signaling (REACT_103669), Opioid Signalling (REACT_15295), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_34578), Adaptive Immunity Signaling (REACT_75774), Beta-catenin phosphorylation cascade (REACT_92934), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_34570), Signalling by NGF (REACT_97378), Glycolysis (REACT_1383), Degradation of beta-catenin by the destruction complex (REACT_81971), MyD88-independent cascade initiated on plasma membrane (REACT_99643), MyD88 cascade initiated on plasma membrane (REACT_81183), Toll Like Receptor 3 (TLR3) Cascade (REACT_99649), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Nuclear Events (kinase and transcription factor activation) (REACT_90219), Formation of Platelet plug (REACT_20), MyD88 dependent cascade initiated on endosome (REACT_25222), M Phase (REACT_910), Glucose metabolism (REACT_723), MyD88 dependent cascade initiated on endosome (REACT_87458), Immune System (REACT_105951), CTLA4 inhibitory signaling (REACT_19405), Activated TLR4 signalling (REACT_90914), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Innate Immunity Signaling (REACT_88681), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_78994), Activated TLR4 signalling (REACT_6890), MyD88-independent cascade initiated on plasma membrane (REACT_6809), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), Innate Immunity Signaling (REACT_6802), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79068), Integration of energy metabolism (REACT_89538), CTLA4 inhibitory signaling (REACT_77110).

These properties come from phylome analysis


molecular_function: binding, protein phosphatase type 2A regulator activity.

cellular_component: protein phosphatase type 2A complex.

biological_process: signal transduction.

These properties come from kegg analysis


KEGG_ORTHOLOGS: protein phosphatase 2 (formerly 2A), regulatory subunit B' (K11584).

molecular_function: protein phosphatase type 2A regulator activity.

Locations

Located in CM3.5_scaffold00003 from 8087606 to 8089396.

This polypeptide in other databases

In PhylomeDB is Phy003AAG7_CUCME .

Related features