Polypeptide MELO3C005757P1
Accession: MELO3C005757P1
Name: MELO3C005757P1
Description: Similar to Luminal-binding protein 5 (Nicotiana tabacum) (uniprot_sprot:sp|Q03685|BIP5_TOBAC)
Sequence:
>MELO3C005757P1 Similar to Luminal-binding protein 5 (Nicotiana tabacum) (uniprot_sprot:sp|Q03685|BIP5_TOBAC) MASSWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSE RLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDMKLVPYKIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKM KETAEAFLGKKIKDAVVTVPAYFNDAQRQATKDAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVS ILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKHGKDISKDNRALGKLRRECERAKRALSSQHQVRVEIESLF DGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKNQIDEIVLVGGSTRIPKVQQLLKDYFEGKEPNKGVNPDEA VAYGAAVQGSILSGEGGEETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERS LTKDCRNLGKFDLTGIPPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNDKGRLSQEEIDRMVREAEEFAEE DKKVKERIDARNSLETYIYNMKNQINDKDKLADKLESDEKEKIETAVKDALEWLDDNQSAEKEDYEEKLKEVEAVCNPII TAVYQRSGGAPGGESAEDDDSHDEL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: 2-alkenal reductase activity, ATP binding.
cellular_component: plasma membrane, endoplasmic reticulum lumen, vacuole, nucleolus, cell wall.
biological_process: oxidation-reduction process, response to cadmium ion, response to stress.
These properties come from reactome analysis
REACTOME_REACTION: Dissociation of PERK:BiP Heterodimer (REACT_18413), Interaction of beta-2-microglobulin (B2M) chain with class I HC (REACT_75898), Release of 78 kDa glucose-regulated protein (REACT_93987), Release of 78 kDa glucose-regulated protein (REACT_91322), Release of 78 kDa glucose-regulated protein (REACT_13546), Dissociation of ATF6-alpha:BiP Complex (REACT_81294), Binding of newly synthesized MHC class I heavy chain (HC) with calnexin (REACT_75754), Release of 78 kDa glucose-regulated protein (REACT_82829), Dissociation of PERK:BiP Heterodimer (REACT_87362), Dissociation of ATF6-alpha:BiP Complex (REACT_18323), Interaction of Erp57 with MHC class I HC (REACT_75930), Dissociation of IRE1:BiP heterodimer (REACT_109282), Dissociation of ATF6-alpha:BiP Complex (REACT_90127), Dissociation of IRE1:BiP heterodimer (REACT_82606), Release of 78 kDa glucose-regulated protein (REACT_57045), Dissociation of IRE1:BiP heterodimer (REACT_18294), Dissociation of IRE1:BiP heterodimer (REACT_102172).
biological_process: antigen processing and presentation of peptide antigen via MHC class I, blood coagulation, platelet activation, platelet degranulation.
REACTOME_COMPLEX: monoglucosylated MHC class I HC:Calnexin/BiP [integral to lumenal side of endoplasmic reticulum membrane, endoplasmic reticulum lumen] (REACT_76535), IRE1:BiP Complex [endoplasmic reticulum membrane] (REACT_18771), ATF6-alpha:BiP Complex [endoplasmic reticulum membrane] (REACT_18758), PERK:BiP Heterodimer [endoplasmic reticulum membrane] (REACT_18951), BiP:unfolded protein complex [endoplasmic reticulum lumen] (REACT_18551), MHC class I HC:Calnexin/BiP:Erp57 [integral to lumenal side of endoplasmic reticulum membrane, endoplasmic reticulum lumen] (REACT_76380).
REACTOME_PATHWAY: Platelet Activation (REACT_29092), Diabetes pathways (REACT_106636), Formation of Platelet plug (REACT_104262), Hemostasis (REACT_604), Platelet Activation (REACT_92635), Platelet degranulation (REACT_100828), Platelet degranulation (REACT_104856), Formation of Platelet plug (REACT_96951), Class I MHC mediated antigen processing & presentation (REACT_75820), Formation of Platelet plug (REACT_83642), Formation of Platelet plug (REACT_84458), Activation of Chaperones by IRE1alpha (REACT_81367), Diabetes pathways (REACT_97252), Response to elevated platelet cytosolic Ca2+ (REACT_80531), Activation of Chaperones by ATF6-alpha (REACT_109119), Response to elevated platelet cytosolic Ca2+ (REACT_1280), Antigen Presentation: Folding, assembly and peptide loading of class I MHC (REACT_75795), Activation of Chaperones by IRE1alpha (REACT_82072), PERK regulated gene expression (REACT_18277), Diabetes pathways (REACT_32886), PERK regulated gene expression (REACT_109000), Response to elevated platelet cytosolic Ca2+ (REACT_79361), Unfolded Protein Response (REACT_18356), Platelet degranulation (REACT_104057), Activation of Chaperones by IRE1alpha (REACT_31649), Adaptive Immunity Signaling (REACT_75774), Platelet degranulation (REACT_80537), Response to elevated platelet cytosolic Ca2+ (REACT_77620), Unfolded Protein Response (REACT_102268), Platelet Activation (REACT_798), Immune System (REACT_6900), Hemostasis (REACT_107268), Hemostasis (REACT_82383), Platelet Activation (REACT_108920), Unfolded Protein Response (REACT_92132), Response to elevated platelet cytosolic Ca2+ (REACT_82854), Hemostasis (REACT_92318), Platelet Activation (REACT_88667), Platelet degranulation (REACT_318), Diabetes pathways (REACT_15380), Unfolded Protein Response (REACT_89826), Activation of Chaperones by IRE1alpha (REACT_18368), Activation of Chaperones by ATF6-alpha (REACT_100135), Hemostasis (REACT_90805), Formation of Platelet plug (REACT_20), Activation of Chaperones by ATF6-alpha (REACT_18348).
These properties come from phylome analysis
molecular_function: misfolded protein binding, chaperone binding, unfolded protein binding, caspase inhibitor activity, ubiquitin protein ligase binding, protein binding, bridging, protein domain specific binding, ATPase activity, calcium ion binding, 2-alkenal reductase activity, ATP binding.
cellular_component: perinuclear region of cytoplasm, melanosome, endoplasmic reticulum chaperone complex, luminal surveillance complex, midbody, integral to endoplasmic reticulum membrane, cell surface, microtubule associated complex, lipid particle, ER-Golgi intermediate compartment, nucleus, endoplasmic reticulum lumen.
biological_process: regulation of protein folding in endoplasmic reticulum, negative regulation of caspase activity, cellular response to glucose starvation, posttranslational protein targeting to membrane, translocation, ER-associated protein catabolic process, sleep, platelet activation, RNA interference, response to unfolded protein, anti-apoptosis, SRP-dependent cotranslational protein targeting to membrane, translocation, platelet degranulation, karyogamy involved in conjugation with cellular fusion, oxidation-reduction process, response to stress.
These properties come from kegg analysis
KEGG_ORTHOLOGS: heat shock 70kDa protein 5 (K09490).
This polypeptide in other databases
In PhylomeDB is Phy003MAKF_CUCME .
