Polypeptide MELO3C009381P1
Accession: MELO3C009381P1
Name: MELO3C009381P1
Description: Similar to Splicing factor 3A subunit 2 (Homo sapiens) (uniprot_sprot:sp|Q15428|SF3A2_HUMAN)
Sequence:
>MELO3C009381P1 Similar to Splicing factor 3A subunit 2 (Homo sapiens) (uniprot_sprot:sp|Q15428|SF3A2_HUMAN) MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTNL AKRAAREAKEAPAQPQPHKRKVSVRKTVKIGRPGYRVTKQFDSETKQRSLLFQIEYPEIEDLAKPRHRFMSSYEQRVQPF DKRYQYLLFAAEPYEIIAFKVPSTEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPQEANKPPPVPAANGTVPSGAPPRPLP PPPQAPPPPPPPPQQGAPPRVPPPPMPGSLPPPPSVMANGPPRPMPPGGAPPIPPPPPVGNNTMANFTPGTQMNRPPMPP PPQSFPGQGIRQPPPPPPNMG*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: zinc ion binding, nucleic acid binding.
cellular_component: nucleus.
These properties come from reactome analysis
REACTOME_REACTION: Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Formation of the Spliceosomal B Complex (REACT_90182), Formation of the Spliceosomal A Complex (REACT_788), Formation of an intermediate Spliceosomal C complex (REACT_91565), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of the active Spliceosomal C complex (REACT_1554), Formation of the active Spliceosomal C complex (REACT_89446), Formation of the active Spliceosomal C complex (REACT_63591), Formation of Exon Junction Complex (REACT_85923), Formation of Exon Junction Complex (REACT_92827), Formation of the Spliceosomal B Complex (REACT_48), Formation of Exon Junction Complex (REACT_774), Formation of an intermediate Spliceosomal C complex (REACT_108009), Formation of the Spliceosomal B Complex (REACT_109266), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
REACTOME_PATHWAY: Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), Gene Expression (REACT_108313), mRNA Splicing - Major Pathway (REACT_467), mRNA Splicing (REACT_107931), Formation and Maturation of mRNA Transcript (REACT_2039), mRNA Splicing - Major Pathway (REACT_93740), Gene Expression (REACT_105649), Gene Expression (REACT_71), mRNA Processing (REACT_29019), mRNA Splicing (REACT_94469), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), mRNA Splicing - Major Pathway (REACT_91611), Formation and Maturation of mRNA Transcript (REACT_32779), Formation and Maturation of mRNA Transcript (REACT_77979), mRNA Processing (REACT_80866), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735).
REACTOME_COMPLEX: Spliceosomal A Complex [nucleoplasm] (REACT_4512), Exon Junction Complex [nucleoplasm] (REACT_2984), U2 snRNP [nucleoplasm] (REACT_3715), SF3A [nucleoplasm] (REACT_5131), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), intron-containing complex [nucleoplasm] (REACT_3239).
biological_process: RNA splicing, gene expression, nuclear mRNA splicing, via spliceosome.
These properties come from phylome analysis
molecular_function: protein binding, zinc ion binding, nucleic acid binding.
cellular_component: catalytic step 2 spliceosome, precatalytic spliceosome, small nuclear ribonucleoprotein complex, spliceosomal complex, nucleoplasm, nucleus.
biological_process: striated muscle myosin thick filament assembly, hermaphrodite genitalia development, locomotion, growth, oviposition, embryo development ending in birth or egg hatching, germ cell development, mitotic spindle organization, receptor-mediated endocytosis, nematode larval development, morphogenesis of an epithelium, nuclear mRNA splicing, via spliceosome, nuclear mRNA 3'-splice site recognition.
These properties come from kegg analysis
KEGG_ORTHOLOGS: splicing factor 3A subunit 2 (K12826).
This polypeptide in other databases
In PhylomeDB is Phy003AA9F_CUCME .
