Polypeptide MELO3C000012P1
Accession: MELO3C000012P1
Name: MELO3C000012P1
Description: Similar to Splicing factor 3B subunit 4 (Homo sapiens) (uniprot_sprot:sp|Q15427|SF3B4_HUMAN)
Sequence:
>MELO3C000012P1 Similar to Splicing factor 3B subunit 4 (Homo sapiens) (uniprot_sprot:sp|Q15427|SF3B4_HUMAN) VSEELLWQLFVQAGPVVNVYVPKDRVTNLHQGYGFIEFRSEEDADYAIKVLNMIKLYGKPIRVNK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleic acid binding, nucleotide binding.
cellular_component: nucleolus.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MC8C_CUCME .
