Polypeptide MELO3C000014P1
Accession: MELO3C000014P1
Name: MELO3C000014P1
Description: Similar to Putative uncharacterized protein (Picea sitchensis) (uniref90:UniRef90_D5AC71)
Sequence:
>MELO3C000014P1 Similar to Putative uncharacterized protein (Picea sitchensis) (uniref90:UniRef90_D5AC71) MSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAIEFLRGNQLTGFWH*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_PATHWAY: Spliceosome (ko03040), RNA degradation (ko03018).
KEGG_ORTHOLOGS: U6 snRNA-associated Sm-like protein LSm7 (K12626).
KEGG_MODULE: Lsm 1-7 complex (M00397), Lsm 2-8 complex (M00396), Spliceosome, U4/U6.U5 tri-snRNP (M00354).
COG: Small nuclear ribonucleoprotein (snRNP) homolog (COG1958).
These properties come from phylome analysis
molecular_function: protein binding, RNA binding.
cellular_component: cytoplasm, nucleolus, U6 snRNP, small nucleolar ribonucleoprotein complex.
biological_process: maturation of SSU-rRNA, tRNA processing, nuclear-transcribed mRNA catabolic process, nuclear mRNA splicing, via spliceosome.
These properties come from blast2go analysis
cellular_component: small nucleolar ribonucleoprotein complex.
This polypeptide in other databases
In PhylomeDB is Phy003LJTO_CUCME .