Polypeptide MELO3C000039P1
Accession: MELO3C000039P1
Name: MELO3C000039P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SIR4)
Sequence:
>MELO3C000039P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_0.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SIR4) MMEVVGAPFVSVGDDTGYYIKCSDNPEFLTGRQAHIIYKGKKIGTFGIVHPEVLENFDIPDPCSLVEVNMESFL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, phenylalanine-tRNA ligase activity, RNA binding, magnesium ion binding.
cellular_component: cytoplasm.
biological_process: phenylalanyl-tRNA aminoacylation.
This polypeptide in other databases
In PhylomeDB is Phy003LMIN_CUCME .

