Polypeptide MELO3C000064P1

Accession: MELO3C000064P1

Name: MELO3C000064P1

Description: Similar to Ent-kaurenoic acid oxidase 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C5Y2|KAO2_ARATH)

Sequence:

>MELO3C000064P1 Similar to Ent-kaurenoic acid oxidase 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C5Y2|KAO2_ARATH)
RLNELWYLVKLGGRAYKSLPPGDLGWPVIGSSFSFYKTFVVQEDPISFIQSLHSRYGKGGIYKTHLYGKPTVIATDPEIC
RRIYLDEAKFKQHYPKSVKILEGSSGEFSKMDHKIAYKLMAAPMNGSE

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: CYP26B1 also deactivates all-trans-retinoic acid by 4-hydroxylation (REACT_97210), CYP26A1 breaks down all-trans-retinoic acid by 4-hydroxylation (REACT_103985), CYP26C1 deactivates 9-cis-retinoic acid by 4-hydroxylation (REACT_93640).

biological_process: xenobiotic metabolic process.

REACTOME_PATHWAY: Cytochrome P450 - arranged by substrate type (REACT_91137), Phase 1 - Functionalization of compounds (REACT_104666), Biological oxidations (REACT_100603), Vitamins (REACT_90099).

These properties come from blast2go analysis


biological_process: metabolic process.

Partial gene: true

Locations

Located in CM3.5_contig31167 from 1080 to 1581.

This polypeptide in other databases

In PhylomeDB is Phy003LK6U_CUCME .

Related features