Polypeptide MELO3C000101P1

Accession: MELO3C000101P1

Name: MELO3C000101P1

Description: Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Cucumis sativus) (uniprot_sprot:sp|Q2QD89|PSAA_CUCSA)

Sequence:

>MELO3C000101P1 Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Cucumis sativus) (uniprot_sprot:sp|Q2QD89|PSAA_CUCSA)
SDVWGSVSDQGVVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQ
ELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: 4 iron, 4 sulfur cluster binding, chlorophyll binding, electron carrier activity, iron ion binding, magnesium ion binding.

cellular_component: integral to membrane, chloroplast thylakoid membrane, photosystem I.

biological_process: electron transport chain, protein-chromophore linkage, photosynthesis, transport.

These properties come from phylome analysis


cellular_component: integral to membrane, photosystem I.

biological_process: photosynthesis.

Partial gene: true

Locations

Located in CM3.5_contig31361 from 1045 to 1458.

This polypeptide in other databases

In PhylomeDB is Phy003A687_CUCME .

Related features