Polypeptide MELO3C000107P1

Accession: MELO3C000107P1

Name: MELO3C000107P1

Description: Similar to 30S ribosomal protein S7, chloroplastic (Manihot esculenta) (uniprot_sprot:sp|B1NWJ5|RR7_MANES)

Sequence:

>MELO3C000107P1 Similar to 30S ribosomal protein S7, chloroplastic (Manihot esculenta) (uniprot_sprot:sp|B1NWJ5|RR7_MANES)
MLVNRILKHGKKSLAYQIIYRAMKKIQQKTETNPLSVLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWL
LGASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: membrane, small ribosomal subunit, thylakoid, chloroplast, mitochondrion.

biological_process: translation.

These properties come from reactome analysis

REACTOME_REACTION: Signal Recognition (Preproinsulin) (REACT_110574), eIF3 and eIF1A bind to the 40S subunit (REACT_608), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_98404), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_30444), Release of 40S and 60S subunits from the 80S ribosome (REACT_86830), Signal Recognition (Preprolactin) (REACT_104150), Signal Recognition (Preproinsulin) (REACT_15319), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), Hydrolysis of eEF1A:GTP (REACT_105040), The 60S subunit joins the translation initiation complex (REACT_32450), Ribosomal scanning (REACT_105772), eIF5B:GTP is hydrolyzed and released (REACT_29113), Formation of the 43S pre-initiation complex (REACT_87583), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_91228), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), Start codon recognition (REACT_31637), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Ribosomal scanning (REACT_95840), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_88081), Ribosomal scanning (REACT_1516), Formation of translation initiation complexes yielding circularized Ceruloplasmin mRNA in a closed-loop conformation (REACT_1515), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), eIF5B:GTP is hydrolyzed and released (REACT_102209), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), Interaction between SRP and SRP Receptor (REACT_15358), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), The 60S subunit joins the translation initiation complex (REACT_198), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Start codon recognition (REACT_78159), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), eIF2:GTP is hydrolyzed, eIFs are released (REACT_1060), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), Release of 40S and 60S subunits from the 80S ribosome (REACT_107539), Signal Recognition (Preproinsulin) (REACT_89495), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_92483), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Hydrolysis of eEF1A:GTP (REACT_552), Interaction between SRP and SRP Receptor (REACT_28872), Interaction between SRP and SRP Receptor (REACT_103640), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_1595), Hydrolysis of eEF1A:GTP (REACT_31077), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_29512), eIF3 and eIF1A bind to the 40S subunit (REACT_77211), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), Formation of the 43S pre-initiation complex (REACT_97597), Hydrolysis of eEF1A:GTP (REACT_31709), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_1904), Interaction between SRP and SRP Receptor (REACT_95183), The 60S subunit joins the translation initiation complex (REACT_83133), eIF3 and eIF1A bind to the 40S subunit (REACT_92158), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Signal Recognition (Preprolactin) (REACT_20565), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), eIF5B:GTP is hydrolyzed and released (REACT_3), Formation of the 43S pre-initiation complex (REACT_1354), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), Translocation of ribosome by 3 bases in the 3 direction (REACT_99354), The 60S subunit joins the translation initiation complex (REACT_101966), Translocation of ribosome by 3 bases in the 3 direction (REACT_90731), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_100731), Ribosomal scanning (REACT_31248), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_81400), Start codon recognition (REACT_656), Signal Recognition (Preprolactin) (REACT_109238), eIF5B:GTP is hydrolyzed and released (REACT_100790).

biological_process: translational termination, translational elongation, mRNA metabolic process, RNA metabolic process, gene expression, cellular protein metabolic process, translation.

REACTOME_COMPLEX: 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), 80S ribosome [cytosol] (REACT_4330), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), 43S complex [cytosol] (REACT_3677), 40S:eIF3:eIF1A [cytosol] (REACT_2456), 43S:mRNA:eIF4F:eIF4B:eIF4H [cytosol] (REACT_4439), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), Preprolactin-SRP Complex [cytosol] (REACT_21159), 48S complex [cytosol] (REACT_5152), phospho-L13a associated wth the 3 UTR GAIT element of ceruloplasmin mRNA within the translation initiation complex [cytosol] (REACT_5151), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), 43S: Ceruloplasmin mRNA:eIF4F:eIF4B:eIF4H:PABP [cytosol] (REACT_3267), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), 40S ribosomal complex [cytosol] (REACT_5094), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), 40S:Met-tRNAi:mRNA [cytosol] (REACT_3073), Preproinsulin-SRP Complex [cytosol] (REACT_15977), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), Elongation complex with growing peptide chain [cytosol] (REACT_5024).

REACTOME_PATHWAY: Translation initiation complex formation (REACT_1979), Eukaryotic Translation Termination (REACT_32804), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_31268), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Nonsense-Mediated Decay (REACT_75886), Formation of the ternary complex, and subsequently, the 43S complex (REACT_85646), Insulin Synthesis and Processing (REACT_92168), Metabolism of RNA (REACT_21257), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_81833), Translation (REACT_77710), Gene Expression (REACT_105649), Insulin Synthesis and Processing (REACT_93978), Translation initiation complex formation (REACT_81317), Metabolism of proteins (REACT_85873), 3 -UTR-mediated translational regulation (REACT_1762), Eukaryotic Translation Elongation (REACT_1477), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Peptide chain elongation (REACT_32702), Cap-dependent Translation Initiation (REACT_2099), Eukaryotic Translation Initiation (REACT_77252), Metabolism of proteins (REACT_86658), Metabolism of proteins (REACT_91052), Gene Expression (REACT_71), Diabetes pathways (REACT_32886), Eukaryotic Translation Initiation (REACT_98138), Peptide chain elongation (REACT_105694), 3 -UTR-mediated translational regulation (REACT_81650), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Ribosomal scanning and start codon recognition (REACT_33832), Peptide chain elongation (REACT_96957), Formation of the ternary complex, and subsequently, the 43S complex (REACT_89669), Eukaryotic Translation Termination (REACT_1986), Gene Expression (REACT_98256), Diabetes pathways (REACT_106636), Eukaryotic Translation Elongation (REACT_82124), Eukaryotic Translation Initiation (REACT_33969), Eukaryotic Translation Initiation (REACT_2159), Formation of a pool of free 40S subunits (REACT_103868), Cap-dependent Translation Initiation (REACT_100314), Diabetes pathways (REACT_97252), Insulin Synthesis and Processing (REACT_15550), Insulin Synthesis and Processing (REACT_98391), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), Metabolism of mRNA (REACT_20605), Cap-dependent Translation Initiation (REACT_94881), Ribosomal scanning and start codon recognition (REACT_33316), Eukaryotic Translation Termination (REACT_93205), 3 -UTR-mediated translational regulation (REACT_28457), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_97139), Translation (REACT_100851), Cap-dependent Translation Initiation (REACT_110387), Ribosomal scanning and start codon recognition (REACT_100129), Gene Expression (REACT_108313), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_102684), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_110187), Formation of a pool of free 40S subunits (REACT_1797), Peptide chain elongation (REACT_1404), Translation (REACT_1014), Metabolism of proteins (REACT_17015), Diabetes pathways (REACT_15380), Formation of the ternary complex, and subsequently, the 43S complex (REACT_1079), Eukaryotic Translation Elongation (REACT_81624), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_1258), Ribosomal scanning and start codon recognition (REACT_931), Formation of a pool of free 40S subunits (REACT_87090), Eukaryotic Translation Elongation (REACT_108858), Formation of a pool of free 40S subunits (REACT_107540).

These properties come from phylome analysis

molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: small ribosomal subunit.

biological_process: translation.

These properties come from kegg analysis

KEGG_ORTHOLOGS: small subunit ribosomal protein S7 (K02992).

cellular_component: cytosolic small ribosomal subunit.

COG: Ribosomal protein S7 (COG0049).

Locations

Located in CM3.5_contig31388 from 1197 to 1592.

This polypeptide in other databases

In PhylomeDB is Phy003A121_CUCME .

Related features