Polypeptide MELO3C000108P1

Accession: MELO3C000108P1

Name: MELO3C000108P1

Description: Similar to 50S ribosomal protein L16, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZN1|RK16_CUCSA)

Sequence:

>MELO3C000108P1 Similar to 50S ribosomal protein L16, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q4VZN1|RK16_CUCSA)
MKGISYRGNSICFGRYAIQALEPAWITSRQIEAGRRAMTRNARRGGKIWVRIFPDKPVTLRPTETRMGSGKGSPEYWVAV
VKPGRILYEMSGVAENIARKAISIAASKMPIRTQFITSG*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: large subunit ribosomal protein L16 (K02878).

cellular_component: cytosolic large ribosomal subunit.

COG: Ribosomal protein L16/L10E (COG0197).

These properties come from phylome analysis


molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: ribosome.

biological_process: translation.

These properties come from blast2go analysis


molecular_function: rRNA binding, structural constituent of ribosome.

cellular_component: chloroplast, ribosome, mitochondrion.

biological_process: translation.

Locations

Located in CM3.5_contig31391 from 1347 to 1706.

This polypeptide in other databases

In PhylomeDB is Phy003AE9E_CUCME .

Related features