Polypeptide MELO3C000111P1

Accession: MELO3C000111P1

Name: MELO3C000111P1

Description: Similar to 50S ribosomal protein L2, chloroplastic (Citrus sinensis) (uniprot_sprot:sp|Q09MB2|RK2_CITSI)

Sequence:

>MELO3C000111P1 Similar to 50S ribosomal protein L2, chloroplastic (Citrus sinensis) (uniprot_sprot:sp|Q09MB2|RK2_CITSI)
MAIHLYKTSTPSTRNGAVDSQVKSNPRNNLIYGQHRCGKGRNARGIITAGHRGGGHKRLYRKIDFRRNEKDIYGRIVTIE
YDPNRNAYICLIHYGDGEKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLSAV*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: large subunit ribosomal protein L2 (K02886).

cellular_component: cytosolic large ribosomal subunit.

COG: Ribosomal protein L2 (COG0090).

These properties come from phylome analysis


molecular_function: transferase activity, structural constituent of ribosome, RNA binding.

cellular_component: large ribosomal subunit.

biological_process: translation.

These properties come from blast2go analysis


molecular_function: transferase activity, structural constituent of ribosome, RNA binding.

cellular_component: large ribosomal subunit, chloroplast, mitochondrion.

biological_process: translation.

Locations

Located in CM3.5_contig31408 from 496 to 897.

This polypeptide in other databases

In PhylomeDB is Phy003LIB0_CUCME .

Related features