Polypeptide MELO3C000117P1

Accession: MELO3C000117P1

Name: MELO3C000117P1

Description: Similar to Alanine aminotransferase 2 (Hordeum vulgare PE=2 SV=1) (uniprot_sprot:sp|P52894|ALA2_HORVU)

Sequence:

>MELO3C000117P1 Similar to Alanine aminotransferase 2 (Hordeum vulgare PE=2 SV=1) (uniprot_sprot:sp|P52894|ALA2_HORVU)
MGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQF
IRESKGILESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIEAAKKLGKVPDVFYCLKLLEATGISTVPGS
GFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDSFMEEYEDHRGYSRM*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_101406), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_78782), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_104823), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT2] (REACT_21263), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_91807), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_94700), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_88337), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_80730), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT2] (REACT_21311), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_29599), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_89745), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_60750), alanine + alpha-ketoglutarate <=> pyruvate + glutamate [GPT] (REACT_196), pyruvate + glutamate <=> alanine + alpha-ketoglutarate [GPT] (REACT_356).

biological_process: cellular nitrogen compound metabolic process, cellular amino acid biosynthetic process.

REACTOME_COMPLEX: GPT dimer [cytosol] (REACT_5396), GPT2 dimer [mitochondrial matrix] (REACT_21918).

REACTOME_PATHWAY: Metabolism of amino acids and derivatives (REACT_13), Metabolism of amino acids and derivatives (REACT_90299), Metabolism of amino acids and derivatives (REACT_86268), Metabolism of amino acids and derivatives (REACT_28699), Metabolism of amino acids and derivatives (REACT_107293), Amino acid synthesis and interconversion (transamination) (REACT_238), Amino acid synthesis and interconversion (transamination) (REACT_101745), Amino acid synthesis and interconversion (transamination) (REACT_33022), Amino acid synthesis and interconversion (transamination) (REACT_109330), Amino acid synthesis and interconversion (transamination) (REACT_110509), Amino acid synthesis and interconversion (transamination) (REACT_30845), Metabolism of amino acids and derivatives (REACT_29108).

These properties come from blast2go analysis


molecular_function: pyridoxal phosphate binding, 1-aminocyclopropane-1-carboxylate synthase activity, transaminase activity.

cellular_component: chloroplast stroma.

biological_process: biosynthetic process.

Locations

Located in CM3.5_contig31450 from 92 to 1472.

This polypeptide in other databases

In PhylomeDB is Phy003A48K_CUCME .

Related features