Polypeptide MELO3C000130P1

Accession: MELO3C000130P1

Name: MELO3C000130P1

Description: Similar to Ribulose bisphosphate carboxylase large chain (Cucumis sativus) (uniprot_sprot:sp|P27064|RBL_CUCSA)

Sequence:

>MELO3C000130P1 Similar to Ribulose bisphosphate carboxylase large chain (Cucumis sativus) (uniprot_sprot:sp|P27064|RBL_CUCSA)
MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDG
LTSLDRYKGRCYGIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPPH
GIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKD

Download fasta sequence.

Properties

These properties come from kegg analysis

KEGG_REACTION: D-Ribulose (R03140), 3-phospho-D-glycerate (R00024).

molecular_function: ribulose-bisphosphate carboxylase activity.

COG: Ribulose 1,5-bisphosphate carboxylase, large subunit (COG1850).

KEGG_PATHWAY: Carbon fixation in photosynthetic organisms (ko00710), Glyoxylate and dicarboxylate metabolism (ko00630).

KEGG_ORTHOLOGS: ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (K01601).

KEGG_MODULE: Reductive pentose phosphate cycle, RuBP + CO2 => glyceraldehyde-3P (M00166), Reductive pentose phosphate cycle (Calvin cycle) (M00165).

These properties come from phylome analysis

molecular_function: ribulose-bisphosphate carboxylase activity, magnesium ion binding.

cellular_component: plastid.

biological_process: carbon fixation.

These properties come from blast2go analysis

molecular_function: ribulose-bisphosphate carboxylase activity, monooxygenase activity, magnesium ion binding.

cellular_component: chloroplast.

biological_process: oxidation-reduction process, reductive pentose-phosphate cycle, photorespiration.

Locations

Located in CM3.5_contig31502 from 1 to 629.

This polypeptide in other databases

In PhylomeDB is Phy003MGGO_CUCME .

Related features