Polypeptide MELO3C000155P1
Accession: MELO3C000155P1
Name: MELO3C000155P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_226.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SPW2)
Sequence:
>MELO3C000155P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_226.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SPW2) FSSDTCKALEMFQENPNNNSLSSILPCEQLLTAKSVLTDVSSEIYDLVNQVNTQIAISYPDIALVCNPFSQSPYYEYQPQ NCAANTIRIGDIPKVNTVTPRKFE
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: cytoplasmic membrane-bounded vesicle, membrane.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003ME7B_CUCME .