Polypeptide MELO3C000173P1

Accession: MELO3C000173P1

Name: MELO3C000173P1

Description: Similar to Photosystem II CP43 chlorophyll apoprotein (Manihot esculenta) (uniprot_sprot:sp|B1NWE6|PSBC_MANES)

Sequence:

>MELO3C000173P1 Similar to Photosystem II CP43 chlorophyll apoprotein (Manihot esculenta) (uniprot_sprot:sp|B1NWE6|PSBC_MANES)
GGGDVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIVGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAY
LSYSLGALSVFFFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEV
IFGGETMRFWDLRAPWLEPLRGPNGLDLSRL*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: photosystem II CP43 chlorophyll apoprotein (K02705).

KEGG_MODULE: Photosystem II (M00161).

These properties come from phylome analysis


molecular_function: chlorophyll binding.

cellular_component: photosystem, integral to membrane.

biological_process: photosynthetic electron transport chain, protein-chromophore linkage.

These properties come from blast2go analysis


molecular_function: electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, chlorophyll binding.

cellular_component: light-harvesting complex, integral to membrane, chloroplast thylakoid membrane, photosystem II.

biological_process: protein-chromophore linkage, photosynthetic electron transport in photosystem II.

Partial gene: true

Locations

Located in CM3.5_contig31722 from 1 to 576.

This polypeptide in other databases

In PhylomeDB is Phy003ABWX_CUCME .

Related features