Polypeptide MELO3C000179P1

Accession: MELO3C000179P1

Name: MELO3C000179P1

Description: Similar to NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q2QD36|NU1C_CUCSA)

Sequence:

>MELO3C000179P1 Similar to NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|Q2QD36|NU1C_CUCSA)
WNLWRQPIGFVIFLISSLAECERLPFDLPEAEEELVAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWDISIPY
ILGYELFEINKVYEVFGMTISIFITLAKTYLFLFISIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSFQLFFFFI
VKEYHILYSRLAQTRESKNKHKIL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: quinone binding, oxidoreductase activity.

cellular_component: integral to membrane, chloroplast thylakoid membrane.

biological_process: oxidation-reduction process.

These properties come from reactome analysis


REACTOME_REACTION: NADH enters the respiratory chain at Complex I (REACT_98202), NADH enters the respiratory chain at Complex I (REACT_6310).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393), Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_101166), Respiratory electron transport (REACT_30834).

REACTOME_COMPLEX: HP subcomplex [mitochondrial inner membrane] (REACT_6454), Complex I - NADH:Ubiquinone oxidoreductase [mitochondrial inner membrane] (REACT_6533).

biological_process: respiratory electron transport chain.

These properties come from kegg analysis


KEGG_PATHWAY: Oxidative phosphorylation (ko00190).

KEGG_ORTHOLOGS: NAD(P)H-quinone oxidoreductase subunit 1 [EC:1.6.5.3] (K05572).

molecular_function: NADH dehydrogenase (ubiquinone) activity.

KEGG_MODULE: NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria (M00145).

COG: NADH:ubiquinone oxidoreductase subunit 1 (chain H) (COG1005).

Partial gene: true

Locations

Located in CM3.5_contig31780 from 577 to 1131.

This polypeptide in other databases

In PhylomeDB is Phy003MD1A_CUCME .

Related features