Polypeptide MELO3C000180P1
Accession: MELO3C000180P1
Name: MELO3C000180P1
Description: Similar to NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Eucalyptus globulus subsp. globulus) (uniprot_sprot:sp|Q49KU4|NDHI_EUCGG)
Sequence:
>MELO3C000180P1 Similar to NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Eucalyptus globulus subsp. globulus) (uniprot_sprot:sp|Q49KU4|NDHI_EUCGG) MVTGFMNYGQQTVRAARYIGQGFMITLSHANRLPVTIQYPYEKLIASERFRGRIHFEFDKCIACE
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: NAD(P)H-quinone oxidoreductase subunit I [EC:1.6.5.3] (K05580).
molecular_function: NADH dehydrogenase (ubiquinone) activity.
COG: Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) (COG1143).
These properties come from phylome analysis
molecular_function: iron-sulfur cluster binding, oxidoreductase activity, electron carrier activity.
cellular_component: plastid.
biological_process: oxidation-reduction process.
These properties come from blast2go analysis
molecular_function: 4 iron, 4 sulfur cluster binding, quinone binding, electron carrier activity, NADH dehydrogenase (ubiquinone) activity, iron ion binding.
cellular_component: chloroplast thylakoid membrane.
biological_process: oxidation-reduction process, photosynthesis, light reaction.
This polypeptide in other databases
In PhylomeDB is Phy003LLCU_CUCME .

