Polypeptide MELO3C000180P1

Accession: MELO3C000180P1

Name: MELO3C000180P1

Description: Similar to NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Eucalyptus globulus subsp. globulus) (uniprot_sprot:sp|Q49KU4|NDHI_EUCGG)

Sequence:

>MELO3C000180P1 Similar to NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Eucalyptus globulus subsp. globulus) (uniprot_sprot:sp|Q49KU4|NDHI_EUCGG)
MVTGFMNYGQQTVRAARYIGQGFMITLSHANRLPVTIQYPYEKLIASERFRGRIHFEFDKCIACE

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: NAD(P)H-quinone oxidoreductase subunit I [EC:1.6.5.3] (K05580).

molecular_function: NADH dehydrogenase (ubiquinone) activity.

COG: Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) (COG1143).

These properties come from phylome analysis


molecular_function: iron-sulfur cluster binding, oxidoreductase activity, electron carrier activity.

cellular_component: plastid.

biological_process: oxidation-reduction process.

These properties come from blast2go analysis


molecular_function: 4 iron, 4 sulfur cluster binding, quinone binding, electron carrier activity, NADH dehydrogenase (ubiquinone) activity, iron ion binding.

cellular_component: chloroplast thylakoid membrane.

biological_process: oxidation-reduction process, photosynthesis, light reaction.

Locations

Located in CM3.5_contig31780 from 1153 to 1347.

This polypeptide in other databases

In PhylomeDB is Phy003LLCU_CUCME .

Related features