Polypeptide MELO3C000215P1
Accession: MELO3C000215P1
Name: MELO3C000215P1
Description: Similar to Mitochondrial outer membrane protein porin of 36 kDa (Solanum tuberosum PE=1 SV=2) (uniprot_sprot:sp|P42056|VDAC2_SOLTU)
Sequence:
>MELO3C000215P1 Similar to Mitochondrial outer membrane protein porin of 36 kDa (Solanum tuberosum PE=1 SV=2) (uniprot_sprot:sp|P42056|VDAC2_SOLTU) IDLQVELQYQHEYAGISTGIGPTANPIVNFAGVIGNEKLSLGIDLSFDTASGNITKLNAGLSYTHSNLIAALTL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: voltage-gated anion channel activity, protein binding.
cellular_component: pore complex, chloroplast, plasma membrane, vacuole, mitochondrial outer membrane.
biological_process: transmembrane transport, anion transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003ABHX_CUCME .

