Polypeptide MELO3C000242P1
Accession: MELO3C000242P1
Name: MELO3C000242P1
Description: Similar to DEAD-box ATP-dependent RNA helicase 52 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M2F9|RH52_ARATH)
Sequence:
>MELO3C000242P1 Similar to DEAD-box ATP-dependent RNA helicase 52 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M2F9|RH52_ARATH) RLASDFLDKYIFLAVGRVGSSTDLIAQRVEYVHEPDKRSHLLDLLHAQRANGVQGK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP-dependent helicase activity, ATP binding, nucleic acid binding.
cellular_component: plastid.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003LJWN_CUCME .