Polypeptide MELO3C000249P1
Accession: MELO3C000249P1
Name: MELO3C000249P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_98.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_E0CV68)
Sequence:
>MELO3C000249P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_98.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_E0CV68) MALEVTQVLLNAQSIDATVRKQAEDSLRQFQEQNLPSFLLSLSSELGSEEKPVDSRKLAGLILKNALDAKEQHRKFELVQ RWLSLDSNVKTQIKACLLNTLSSAVADARSTASQVIAKIAGIELPHKQWPELIGSLLLNVHQQSSH
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_PATHWAY: RNA transport (ko03013).
KEGG_ORTHOLOGS: importin subunit beta-1 (K14293).
These properties come from blast2go analysis
molecular_function: protein transporter activity, binding.
cellular_component: nuclear pore.
biological_process: protein import into nucleus, docking.
This polypeptide in other databases
In PhylomeDB is Phy003A65K_CUCME .

