Polypeptide MELO3C000253P1
Accession: MELO3C000253P1
Name: MELO3C000253P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_16.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TB70)
Sequence:
>MELO3C000253P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_16.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TB70) MAEKPQPVRVLYCPVCSLPAEYCEFGPDFEKCKPWLIQNAPDLYPDLLKEANAKEAGEVSNQLQSTSISSAAGDGAASS
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: translation initiation factor activity.
biological_process: translational initiation.
These properties come from phylome analysis
molecular_function: protein binding, translation initiation factor activity.
cellular_component: ribosome.
This polypeptide in other databases
In PhylomeDB is Phy003LMN4_CUCME .

