Polypeptide MELO3C000260P1
Accession: MELO3C000260P1
Name: MELO3C000260P1
Description: Similar to MADS-box transcription factor 3 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q40704|MADS3_ORYSJ)
Sequence:
>MELO3C000260P1 Similar to MADS-box transcription factor 3 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q40704|MADS3_ORYSJ) MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: sequence-specific DNA binding, sequence-specific DNA binding transcription factor activity.
cellular_component: nucleus.
biological_process: regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003MEMH_CUCME .
