Polypeptide MELO3C000273P1

Accession: MELO3C000273P1

Name: MELO3C000273P1

Description: Similar to Probable prefoldin subunit 5 (Arabidopsis thaliana) (uniprot_sprot:sp|P57742|PFD5_ARATH)

Sequence:

>MELO3C000273P1 Similar to Probable prefoldin subunit 5 (Arabidopsis thaliana) (uniprot_sprot:sp|P57742|PFD5_ARATH)
MEVNLLHDSLNNIRTATSRLDIASAALHDLSLRPQGKRMFVPLTASLYVPGTLDEADKVLVDVGTGYFIE

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: unfolded protein binding.

cellular_component: prefoldin complex.

biological_process: protein folding.

These properties come from reactome analysis


REACTOME_REACTION: unfolded actin/tubulin associates with prefoldin (REACT_16892), unfolded actin/tubulin associates with prefoldin (REACT_29326), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_79699), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_82740), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_16961), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_91786), unfolded actin/tubulin associates with prefoldin (REACT_94084), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_109317), unfolded actin/tubulin associates with prefoldin (REACT_82152).

biological_process: 'de novo' posttranslational protein folding, cellular protein metabolic process, protein folding.

REACTOME_COMPLEX: Prefoldin-associated actin/tubulin [cytosol] (REACT_18141), Prefoldin [cytosol] (REACT_17255).

REACTOME_PATHWAY: Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_94344), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_16936), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_78563), Protein folding (REACT_16952), Chaperonin-mediated protein folding (REACT_104912), Protein folding (REACT_90475), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_93325), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_87227), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_17029), Chaperonin-mediated protein folding (REACT_17004), Metabolism of proteins (REACT_91052), Protein folding (REACT_100416), Chaperonin-mediated protein folding (REACT_100411), Metabolism of proteins (REACT_85873), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_91371), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_34237), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_80983), Metabolism of proteins (REACT_86658), Protein folding (REACT_85464), Metabolism of proteins (REACT_17015), Chaperonin-mediated protein folding (REACT_106927), Chaperonin-mediated protein folding (REACT_32155), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_81425), Metabolism of proteins (REACT_102155), Protein folding (REACT_30135).

These properties come from kegg analysis


KEGG_ORTHOLOGS: prefoldin alpha subunit (K04797).

COG: Predicted prefoldin, molecular chaperone implicated in de novo protein folding (COG1730).

Locations

Located in CM3.5_contig32370 from 437 to 744.

This polypeptide in other databases

In PhylomeDB is Phy003LFNQ_CUCME .

Related features