Polypeptide MELO3C000277P1

Accession: MELO3C000277P1

Name: MELO3C000277P1

Description: Similar to Cytochrome b6 (Cucumis sativus) (uniprot_sprot:sp|Q4VZI6|CYB6_CUCSA)

Sequence:

>MELO3C000277P1 Similar to Cytochrome b6 (Cucumis sativus) (uniprot_sprot:sp|Q4VZI6|CYB6_CUCSA)
MTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGV
TGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTFVFFIVYTLLYYLFLLPYLC*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity, oxidoreductase activity, iron ion binding.

cellular_component: integral to membrane, chloroplast thylakoid membrane.

biological_process: respiratory electron transport chain, photosynthesis, transport.

These properties come from reactome analysis


biological_process: respiratory electron transport chain.

REACTOME_REACTION: Electron transfer from ubiquinol to cytochrome c of complex III (REACT_6300).

REACTOME_COMPLEX: Ubiquinol-cytochrome c reductase [mitochondrial inner membrane] (REACT_6527), cytochrome b-heme complex [mitochondrial inner membrane] (REACT_6552).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393).

These properties come from phylome analysis


molecular_function: metal ion binding, electron carrier activity, ubiquinol-cytochrome-c reductase activity, oxidoreductase activity.

cellular_component: respiratory chain, mitochondrial respiratory chain complex III, mitochondrial inner membrane, mitochondrion, integral to membrane.

biological_process: visual perception, mitochondrial electron transport, ubiquinol to cytochrome c, respiratory electron transport chain, transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: cytochrome b6 (K02635).

KEGG_MODULE: Cytochrome b6f complex (M00162).

COG: Cytochrome b subunit of the bc complex (COG1290).

Locations

Located in CM3.5_contig32403 from 400 to 846.

This polypeptide in other databases

In PhylomeDB is Phy003LL8Q_CUCME .

Related features