Polypeptide MELO3C000277P1
Accession: MELO3C000277P1
Name: MELO3C000277P1
Description: Similar to Cytochrome b6 (Cucumis sativus) (uniprot_sprot:sp|Q4VZI6|CYB6_CUCSA)
Sequence:
>MELO3C000277P1 Similar to Cytochrome b6 (Cucumis sativus) (uniprot_sprot:sp|Q4VZI6|CYB6_CUCSA) MTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGV TGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTFVFFIVYTLLYYLFLLPYLC*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity, oxidoreductase activity, iron ion binding.
cellular_component: integral to membrane, chloroplast thylakoid membrane.
biological_process: respiratory electron transport chain, photosynthesis, transport.
These properties come from reactome analysis
biological_process: respiratory electron transport chain.
REACTOME_REACTION: Electron transfer from ubiquinol to cytochrome c of complex III (REACT_6300).
REACTOME_COMPLEX: Ubiquinol-cytochrome c reductase [mitochondrial inner membrane] (REACT_6527), cytochrome b-heme complex [mitochondrial inner membrane] (REACT_6552).
REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393).
These properties come from phylome analysis
molecular_function: metal ion binding, electron carrier activity, ubiquinol-cytochrome-c reductase activity, oxidoreductase activity.
cellular_component: respiratory chain, mitochondrial respiratory chain complex III, mitochondrial inner membrane, mitochondrion, integral to membrane.
biological_process: visual perception, mitochondrial electron transport, ubiquinol to cytochrome c, respiratory electron transport chain, transport.
These properties come from kegg analysis
KEGG_ORTHOLOGS: cytochrome b6 (K02635).
KEGG_MODULE: Cytochrome b6f complex (M00162).
COG: Cytochrome b subunit of the bc complex (COG1290).
This polypeptide in other databases
In PhylomeDB is Phy003LL8Q_CUCME .

