Polypeptide MELO3C000296P1
Accession: MELO3C000296P1
Name: MELO3C000296P1
Description: Similar to Putative uncharacterized protein (Ricinus communis) (uniref90:UniRef90_B9RS93)
Sequence:
>MELO3C000296P1 Similar to Putative uncharacterized protein (Ricinus communis) (uniref90:UniRef90_B9RS93) MGVDYYNILKVNRNANDDDLKKAYRRLAMKWHPDKNPNNKKEAETKFKQISEAYEARF
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: unfolded protein binding, heat shock protein binding.
biological_process: protein folding.
These properties come from phylome analysis
molecular_function: unfolded protein binding, heat shock protein binding.
biological_process: protein folding.
This polypeptide in other databases
In PhylomeDB is Phy003MF5X_CUCME .
