Polypeptide MELO3C000312P1
Accession: MELO3C000312P1
Name: MELO3C000312P1
Description: Similar to ATP synthase subunit alpha, mitochondrial (Phaseolus vulgaris) (uniprot_sprot:sp|P24459|ATPAM_PHAVU)
Sequence:
>MELO3C000312P1 Similar to ATP synthase subunit alpha, mitochondrial (Phaseolus vulgaris) (uniprot_sprot:sp|P24459|ATPAM_PHAVU) MLGHVVDALGAPIDGRGALSDLERRRVKVKASRIIECKSVHEPMQTGLKAVDSLVPIDRGQ*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism, ATP binding.
cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), mitochondrion.
biological_process: plasma membrane ATP synthesis coupled proton transport.
These properties come from phylome analysis
molecular_function: hydrolase activity.
This polypeptide in other databases
In PhylomeDB is Phy003MCG1_CUCME .