Polypeptide MELO3C000340P1
Accession: MELO3C000340P1
Name: MELO3C000340P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_25.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TV79)
Sequence:
>MELO3C000340P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_25.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7TV79) MTGIAQNNPSILNMTLVQAYGTVVDSLAAHISYFMVVSDNHISQPRWCCDNNDGNDFFGDRYIDPQEWLQGISFATQSLK SKSQ
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: hydrolase activity, binding.
cellular_component: cytoplasmic membrane-bounded vesicle.
This polypeptide in other databases
In PhylomeDB is Phy003MD0T_CUCME .
