Polypeptide MELO3C000351P1
Accession: MELO3C000351P1
Name: MELO3C000351P1
Description: Similar to 40S ribosomal protein S13 (Glycine max) (uniprot_sprot:sp|P62302|RS13_SOYBN)
Sequence:
>MELO3C000351P1 Similar to 40S ribosomal protein S13 (Glycine max) (uniprot_sprot:sp|P62302|RS13_SOYBN) LAPEIPEDLYHFIKKAVSIRKHLERNRKDKDSKFKLILVESRIHRLARYYKKTKKVPPVWK*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Signal Recognition (Preproinsulin) (REACT_15319), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_31671), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_77497), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), Ribosomal scanning (REACT_91084), Hydrolysis of eEF1A:GTP (REACT_108111), Ribosomal scanning (REACT_95840), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), eIF5B:GTP is hydrolyzed and released (REACT_3), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), Interaction between SRP and SRP Receptor (REACT_83835), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_92483), Release of 40S and 60S subunits from the 80S ribosome (REACT_81831), Release of 40S and 60S subunits from the 80S ribosome (REACT_86830), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_28090), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Translocation of ribosome by 3 bases in the 3 direction (REACT_99354), The 60S subunit joins the translation initiation complex (REACT_101966), Signal Recognition (Preproinsulin) (REACT_102110), The 60S subunit joins the translation initiation complex (REACT_32450), eIF5B:GTP is hydrolyzed and released (REACT_100790), eIF3 and eIF1A bind to the 40S subunit (REACT_608), Signal Recognition (Preprolactin) (REACT_104150), Signal Recognition (Preproinsulin) (REACT_110574), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), Formation of the 43S pre-initiation complex (REACT_87583), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_91228), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Interaction between SRP and SRP Receptor (REACT_103640), Start codon recognition (REACT_104947), eIF5B:GTP is hydrolyzed and released (REACT_102209), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), eIF3 and eIF1A bind to the 40S subunit (REACT_34386), Signal Recognition (Preprolactin) (REACT_106280), Formation of the 43S pre-initiation complex (REACT_90953), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_79315), Hydrolysis of eEF1A:GTP (REACT_105040), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), Interaction between SRP and SRP Receptor (REACT_28872), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_1595), Hydrolysis of eEF1A:GTP (REACT_31077), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_1904), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_29512), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_100731), Formation of the 43S pre-initiation complex (REACT_1354), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_31222), Formation of the 43S pre-initiation complex (REACT_97597), Ribosomal scanning (REACT_96533), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_81400), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_98404), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_30444), Start codon recognition (REACT_31637), Hydrolysis of eEF1A:GTP (REACT_80598), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Ribosomal scanning (REACT_1516), Formation of translation initiation complexes yielding circularized Ceruloplasmin mRNA in a closed-loop conformation (REACT_1515), Translocation of ribosome by 3 bases in the 3 direction (REACT_90731), Interaction between SRP and SRP Receptor (REACT_99006), Signal Recognition (Preproinsulin) (REACT_82519), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_88081), Interaction between SRP and SRP Receptor (REACT_15358), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Interaction between SRP and SRP Receptor (REACT_95183), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Start codon recognition (REACT_78159), Start codon recognition (REACT_33398), Release of 40S and 60S subunits from the 80S ribosome (REACT_107539), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_84975), eIF3 and eIF1A bind to the 40S subunit (REACT_77211), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), Signal Recognition (Preproinsulin) (REACT_89495), Ribosomal scanning (REACT_31248), Signal Recognition (Preprolactin) (REACT_109238), The 60S subunit joins the translation initiation complex (REACT_107675), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_78279), eIF5B:GTP is hydrolyzed and released (REACT_29113), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), The 60S subunit joins the translation initiation complex (REACT_81721), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81196), Release of 40S and 60S subunits from the 80S ribosome (REACT_100903), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_108032), The 60S subunit joins the translation initiation complex (REACT_198), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_107771), eIF2:GTP is hydrolyzed, eIFs are released (REACT_1060), Formation of the 43S pre-initiation complex (REACT_103916), Signal Recognition (Preprolactin) (REACT_100079), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Hydrolysis of eEF1A:GTP (REACT_552), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_102180), eIF5B:GTP is hydrolyzed and released (REACT_81139), Start codon recognition (REACT_656), eIF3 and eIF1A bind to the 40S subunit (REACT_32878), Hydrolysis of eEF1A:GTP (REACT_31709), Ribosomal scanning (REACT_105772), The 60S subunit joins the translation initiation complex (REACT_83133), eIF3 and eIF1A bind to the 40S subunit (REACT_92158), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Signal Recognition (Preprolactin) (REACT_20565), eIF5B:GTP is hydrolyzed and released (REACT_88603), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_91109).
biological_process: translational elongation, translational termination, gene expression, mRNA metabolic process, RNA metabolic process, cellular protein metabolic process, translation.
REACTOME_COMPLEX: 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), 80S ribosome [cytosol] (REACT_4330), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), 43S complex [cytosol] (REACT_3677), 40S:eIF3:eIF1A [cytosol] (REACT_2456), 43S:mRNA:eIF4F:eIF4B:eIF4H [cytosol] (REACT_4439), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), Preprolactin-SRP Complex [cytosol] (REACT_21159), 48S complex [cytosol] (REACT_5152), phospho-L13a associated wth the 3 UTR GAIT element of ceruloplasmin mRNA within the translation initiation complex [cytosol] (REACT_5151), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), 43S: Ceruloplasmin mRNA:eIF4F:eIF4B:eIF4H:PABP [cytosol] (REACT_3267), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), 40S ribosomal complex [cytosol] (REACT_5094), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), 40S:Met-tRNAi:mRNA [cytosol] (REACT_3073), Preproinsulin-SRP Complex [cytosol] (REACT_15977), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), Elongation complex with growing peptide chain [cytosol] (REACT_5024).
REACTOME_PATHWAY: Ribosomal scanning and start codon recognition (REACT_29174), Ribosomal scanning and start codon recognition (REACT_92962), Insulin Synthesis and Processing (REACT_93978), Cap-dependent Translation Initiation (REACT_29674), Diabetes pathways (REACT_106585), Insulin Synthesis and Processing (REACT_92168), Peptide chain elongation (REACT_87004), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_77710), Eukaryotic Translation Termination (REACT_103749), Metabolism of proteins (REACT_86658), Formation of a pool of free 40S subunits (REACT_87090), Eukaryotic Translation Initiation (REACT_98138), Formation of a pool of free 40S subunits (REACT_107540), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_34253), Insulin Synthesis and Processing (REACT_98207), Formation of the ternary complex, and subsequently, the 43S complex (REACT_89669), Insulin Synthesis and Processing (REACT_78124), Formation of the ternary complex, and subsequently, the 43S complex (REACT_77868), Translation (REACT_81833), Cap-dependent Translation Initiation (REACT_100314), 3 -UTR-mediated translational regulation (REACT_105496), Ribosomal scanning and start codon recognition (REACT_33832), Eukaryotic Translation Elongation (REACT_30678), Eukaryotic Translation Termination (REACT_93205), Eukaryotic Translation Initiation (REACT_77252), Eukaryotic Translation Initiation (REACT_30389), Peptide chain elongation (REACT_1404), Metabolism of RNA (REACT_21257), Gene Expression (REACT_105649), Diabetes pathways (REACT_15380), Eukaryotic Translation Elongation (REACT_81624), Ribosomal scanning and start codon recognition (REACT_931), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_102684), Eukaryotic Translation Termination (REACT_32804), Nonsense-Mediated Decay (REACT_75886), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_28708), Peptide chain elongation (REACT_106978), Ribosomal scanning and start codon recognition (REACT_100129), Formation of a pool of free 40S subunits (REACT_30395), Gene Expression (REACT_71), Diabetes pathways (REACT_32886), 3 -UTR-mediated translational regulation (REACT_81650), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Eukaryotic Translation Termination (REACT_1986), Gene Expression (REACT_98256), Eukaryotic Translation Initiation (REACT_2159), Insulin Synthesis and Processing (REACT_98391), Gene Expression (REACT_108313), Cap-dependent Translation Initiation (REACT_98846), Ribosomal scanning and start codon recognition (REACT_33316), Cap-dependent Translation Initiation (REACT_110387), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_97139), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), Gene Expression (REACT_91657), Metabolism of proteins (REACT_99179), Metabolism of proteins (REACT_17015), 3 -UTR-mediated translational regulation (REACT_31427), Translation (REACT_105544), Formation of a pool of free 40S subunits (REACT_103868), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Eukaryotic Translation Elongation (REACT_93503), Diabetes pathways (REACT_97252), Formation of the ternary complex, and subsequently, the 43S complex (REACT_81478), 3 -UTR-mediated translational regulation (REACT_1762), Peptide chain elongation (REACT_32702), Cap-dependent Translation Initiation (REACT_2099), Translation (REACT_86996), Diabetes pathways (REACT_32548), Metabolism of mRNA (REACT_20605), Insulin Synthesis and Processing (REACT_15550), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_96420), 3 -UTR-mediated translational regulation (REACT_28457), Translation (REACT_100851), Translation initiation complex formation (REACT_81317), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_110187), Formation of a pool of free 40S subunits (REACT_102010), Formation of the ternary complex, and subsequently, the 43S complex (REACT_1079), Metabolism of proteins (REACT_102155), Formation of the ternary complex, and subsequently, the 43S complex (REACT_85646), Translation initiation complex formation (REACT_1979), Diabetes pathways (REACT_106636), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_104915), Peptide chain elongation (REACT_96957), Gene Expression (REACT_85241), Eukaryotic Translation Elongation (REACT_1477), Metabolism of proteins (REACT_91052), Peptide chain elongation (REACT_105694), Metabolism of proteins (REACT_85873), Eukaryotic Translation Elongation (REACT_82124), Eukaryotic Translation Initiation (REACT_33969), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_31268), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), Cap-dependent Translation Initiation (REACT_94881), Formation of a pool of free 40S subunits (REACT_1797), Translation (REACT_1014), Eukaryotic Translation Initiation (REACT_91066), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_1258), Eukaryotic Translation Termination (REACT_94463), Eukaryotic Translation Elongation (REACT_108858).
These properties come from blast2go analysis
molecular_function: structural constituent of ribosome.
cellular_component: cytosolic small ribosomal subunit, membrane.
biological_process: translation.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEMK_CUCME .
