Polypeptide MELO3C000374P1
Accession: MELO3C000374P1
Name: MELO3C000374P1
Description: Similar to Coatomer subunit beta'-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C827|COB22_ARATH)
Sequence:
>MELO3C000374P1 Similar to Coatomer subunit beta'-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C827|COB22_ARATH) VVIGYDEGTIMVKLGREVPIASMDNGGKIIWAKHNEIQTVNIKSVGADFE
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: myosin heavy chain kinase activity, protein binding, structural molecule activity.
cellular_component: membrane coat.
biological_process: vesicle-mediated transport, intracellular protein transport.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003LMWM_CUCME .
