Polypeptide MELO3C000399P1

Accession: MELO3C000399P1

Name: MELO3C000399P1

Description: Similar to Cytochrome b6-f complex subunit 4 (Nymphaea alba) (uniprot_sprot:sp|Q6EW21|PETD_NYMAL)

Sequence:

>MELO3C000399P1 Similar to Cytochrome b6-f complex subunit 4 (Nymphaea alba) (uniprot_sprot:sp|Q6EW21|PETD_NYMAL)
MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVA
LWLGIGATLPIDKSLTLGLFFFFY*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: cytochrome b6-f complex subunit 4 (K02637).

COG: Cytochrome b subunit of the bc complex (COG1290).

These properties come from phylome analysis


molecular_function: electron carrier activity, electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, oxidoreductase activity.

cellular_component: thylakoid membrane, membrane.

biological_process: respiratory electron transport chain, photosynthetic electron transport chain.

These properties come from blast2go analysis


molecular_function: electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity, electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, oxidoreductase activity.

cellular_component: integral to membrane, chloroplast thylakoid membrane.

biological_process: respiratory electron transport chain, photosynthetic electron transport chain, transport.

Locations

Located in CM3.5_contig33119 from 718 to 1032.

This polypeptide in other databases

In PhylomeDB is Phy003LIWB_CUCME .

Related features