Polypeptide MELO3C000482P1
Accession: MELO3C000482P1
Name: MELO3C000482P1
Description: Similar to ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Pisum sativum PE=2 SV=1) (uniprot_sprot:sp|P35100|CLPC_PEA)
Sequence:
>MELO3C000482P1 Similar to ATP-dependent Clp protease ATP-binding subunit clpC homolog, chloroplastic (Pisum sativum PE=2 SV=1) (uniprot_sprot:sp|P35100|CLPC_PEA) VITLDMGLLVACTKYRGEFEERLKKLMEEIKQSDGAGAAEGAIDAAKILKPALARGQLQ
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleoside-triphosphatase activity, peptidase activity, ATP binding, protein binding, nuclease activity, DNA binding.
cellular_component: chloroplast stroma, chloroplast thylakoid membrane, cell wall.
biological_process: protein metabolic process, nucleotide-excision repair.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MHY0_CUCME .
