Polypeptide MELO3C000500P1

Accession: MELO3C000500P1

Name: MELO3C000500P1

Description: Similar to Photosystem II CP47 chlorophyll apoprotein (Amborella trichopoda) (uniprot_sprot:sp|Q70XY1|PSBB_AMBTC)

Sequence:

>MELO3C000500P1 Similar to Photosystem II CP47 chlorophyll apoprotein (Amborella trichopoda) (uniprot_sprot:sp|Q70XY1|PSBB_AMBTC)
FVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSTGLAENQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGS
MDNGDGIAVDGDGIVRADVPFRRAESKYSVEQ

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: photosystem II CP47 chlorophyll apoprotein (K02704).

These properties come from phylome analysis


molecular_function: chlorophyll binding.

cellular_component: integral to membrane, photosystem.

biological_process: protein-chromophore linkage, photosynthetic electron transport chain.

These properties come from blast2go analysis


cellular_component: photosystem, chloroplast.

biological_process: electron transport chain, photosynthesis, light reaction.

Partial gene: true

Locations

Located in CM3.5_contig33717 from 43 to 491.

This polypeptide in other databases

In PhylomeDB is Phy003MJKN_CUCME .

Related features