Polypeptide MELO3C000512P1

Accession: MELO3C000512P1

Name: MELO3C000512P1

Description: Similar to Metal transporter Nramp6 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9S9N8|NRAM6_ARATH)

Sequence:

>MELO3C000512P1 Similar to Metal transporter Nramp6 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9S9N8|NRAM6_ARATH)
MQGFLDLKLTPWIRNFLTRSLAIVPSLIVAIIGGSSGAGKLIIIASMILSFELPFALVPLLKFTSSKAKMGPH

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: NRAMP1 transports divalent metal ions across phagosomal membranes of macrophages (REACT_32699), DCT1 (NRAMP2) mediates divalent iron uptake across the apical membrane of enterocytes (REACT_83241).

biological_process: transmembrane transport, cellular iron ion homeostasis.

REACTOME_PATHWAY: Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds (REACT_105287), SLC-mediated transmembrane transport (REACT_87124), Iron uptake and transport (REACT_84782), Metal ion SLC transporters (REACT_79797), Transmembrane transport of small molecules (REACT_81024).

These properties come from phylome analysis


molecular_function: transporter activity.

cellular_component: membrane.

These properties come from blast2go analysis


molecular_function: transporter activity.

cellular_component: membrane.

biological_process: transport.

Locations

Located in CM3.5_contig33824 from 109 to 957.

This polypeptide in other databases

In PhylomeDB is Phy003LKVA_CUCME .

Related features