Polypeptide MELO3C000527P1
Accession: MELO3C000527P1
Name: MELO3C000527P1
Description: Similar to TIR-NBS-LRR disease resistance protein (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GB33)
Sequence:
>MELO3C000527P1 Similar to TIR-NBS-LRR disease resistance protein (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GB33) LPSCLHKFMSLWNLELRNCKFLQEIPNLPQNIQNLDASGCKSLARSPDNIVDIISIKQVRFFPFILFLSST*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleoside-triphosphatase activity, ATP binding, protein binding, transmembrane receptor activity.
cellular_component: intrinsic to membrane.
biological_process: innate immune response, signal transduction, apoptosis.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEJW_CUCME .
