Polypeptide MELO3C000603P1
Accession: MELO3C000603P1
Name: MELO3C000603P1
Description: Similar to Xanthine dehydrogenase, putative (Ricinus communis) (uniref90:UniRef90_B9RIB6)
Sequence:
>MELO3C000603P1 Similar to Xanthine dehydrogenase, putative (Ricinus communis) (uniref90:UniRef90_B9RIB6) AGALVHVYTDGTVLVTHGGVEMGQGLHTKVAQVAASAFNIPLSSVFISETSTDK
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: 2 iron, 2 sulfur cluster binding, flavin adenine dinucleotide binding, electron carrier activity, iron ion binding, xanthine oxidase activity, xanthine dehydrogenase activity.
biological_process: oxidation-reduction process.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MEI5_CUCME .

