Polypeptide MELO3C000684P1

Accession: MELO3C000684P1

Name: MELO3C000684P1

Description: Similar to Lipoxygenase 2, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|P38418|LOX2_ARATH)

Sequence:

>MELO3C000684P1 Similar to Lipoxygenase 2, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|P38418|LOX2_ARATH)
MSAYVNHYYPDENAIKNDKELIAWWEEIKEKGHPDKKKAAGWPSLKTPKDLIQIVSTIAWVGCGHHSAVNFIQYAHAGYF
PSRPSIARTNMPTEDFDQIPEEFIDNPESVILEAFPSIAQASTVAQTMLILSAHSPDEEYIGKKIEPAWAEDPTIARAFE
KFKMRLNKLEKTIDKRNENSELKNRHGAGLVPYEVLKPTSDYGVTGKGVPYSVST*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Oxidation of arachidonic acid to 5-HpETE (REACT_15337), ALOX5 is phosphorylated by MAPKAP2 (REACT_22105), Dehydration of 5-HpETE to leukotriene A4 (REACT_15453).

biological_process: leukotriene biosynthetic process, prostanoid metabolic process.

REACTOME_COMPLEX: ALOX5 (iron, calcium cofactors) [cytosol] (REACT_16091).

REACTOME_PATHWAY: Metabolism of lipids and lipoproteins (REACT_22258), Prostanoid metabolism (REACT_15369), Leukotriene synthesis (REACT_15354).

These properties come from blast2go analysis


molecular_function: metal ion binding, oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen.

biological_process: fatty acid biosynthetic process.

Locations

Located in CM3.5_contig34978 from 8 to 655.

This polypeptide in other databases

In PhylomeDB is Phy003MALA_CUCME .

Related features