Polypeptide MELO3C000703P1

Accession: MELO3C000703P1

Name: MELO3C000703P1

Description: Similar to Glycogen synthase kinase-3 homolog MsK-3 (Medicago sativa) (uniprot_sprot:sp|P51139|MSK3_MEDSA)

Sequence:

>MELO3C000703P1 Similar to Glycogen synthase kinase-3 homolog MsK-3 (Medicago sativa) (uniprot_sprot:sp|P51139|MSK3_MEDSA)
MAERAVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFSTTEKDELYLNLVLEYVPE
TVHRVIKHYNKMNQRMPLIYVKLYFYQICRALSYIHNSIGVCHRDIKPQNLLV

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_31296), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_87470), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_101640), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_31799), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_34050), AKT phosphorylates GSK3 (REACT_108360), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_109807), Phosphorylation of APC component of the destruction complex (REACT_90760), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_87315).

REACTOME_PATHWAY: PI3K/AKT activation (REACT_97931), Beta-catenin phosphorylation cascade (REACT_102439), Signaling by Wnt (REACT_89971), Signaling by FGFR (REACT_103577), Degradation of beta-catenin by the destruction complex (REACT_89447), Signalling by NGF (REACT_82110), NGF signalling via TRKA from the plasma membrane (REACT_100895), PIP3 activates AKT signaling (REACT_106479), AKT phosphorylates targets in the cytosol (REACT_77637), PI-3K cascade (REACT_107804), Downstream signaling of activated FGFR (REACT_109146).

biological_process: fibroblast growth factor receptor signaling pathway, nerve growth factor receptor signaling pathway, phosphatidylinositol-mediated signaling.

These properties come from blast2go analysis


molecular_function: tau-protein kinase activity, ATP binding, protein serine/threonine kinase activity.

biological_process: protein phosphorylation.

Locations

Located in CM3.5_contig35149 from 110 to 791.

This polypeptide in other databases

In PhylomeDB is Phy003MJ8B_CUCME .

Related features