Polypeptide MELO3C000729P1
Accession: MELO3C000729P1
Name: MELO3C000729P1
Description: Similar to NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|P0CC51|NU2C2_CUCSA)
Sequence:
>MELO3C000729P1 Similar to NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic (Cucumis sativus) (uniprot_sprot:sp|P0CC51|NU2C2_CUCSA) MAITEFLLFVLTATLGGMFLCGANDLITIFVAPECFSLCSYLLSGYTKKD
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: NAD(P)H-quinone oxidoreductase subunit 2 [EC:1.6.5.3] (K05573).
molecular_function: NADH dehydrogenase (ubiquinone) activity.
COG: NADH:ubiquinone oxidoreductase subunit 2 (chain N) (COG1007).
These properties come from blast2go analysis
molecular_function: quinone binding, NADH dehydrogenase (ubiquinone) activity.
cellular_component: chloroplast thylakoid membrane.
biological_process: ATP synthesis coupled electron transport.
This polypeptide in other databases
In PhylomeDB is Phy003MCNV_CUCME .

