Polypeptide MELO3C000762P1
Accession: MELO3C000762P1
Name: MELO3C000762P1
Description: Similar to Proteasome subunit beta type-3 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q9LST7|PSB3_ORYSJ)
Sequence:
>MELO3C000762P1 Similar to Proteasome subunit beta type-3 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q9LST7|PSB3_ORYSJ) MVGKNCFAIASDRRLGVQLQTIATDFQKIYRIHDKLFLGLSGLGTDAQTLYQRLVYQHKLYQLREERDMKPETFASLVST RLYEK
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_PATHWAY: Proteasome (ko03050).
KEGG_ORTHOLOGS: 20S proteasome subunit beta 3 [EC:3.4.25.1] (K02735).
KEGG_MODULE: Proteasome, 20S core particle (M00340), Immunoproteasome (M00337).
COG: 20S proteasome, alpha and beta subunits (COG0638).
These properties come from blast2go analysis
molecular_function: threonine-type endopeptidase activity.
cellular_component: cytoplasmic membrane-bounded vesicle, plasma membrane, proteasome core complex, nucleus.
biological_process: ubiquitin-dependent protein catabolic process.
This polypeptide in other databases
In PhylomeDB is Phy003AC56_CUCME .

