Polypeptide MELO3C000776P1

Accession: MELO3C000776P1

Name: MELO3C000776P1

Description: Similar to Probable aquaporin PIP1-4 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39196|PIP14_ARATH)

Sequence:

>MELO3C000776P1 Similar to Probable aquaporin PIP1-4 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39196|PIP14_ARATH)
MVMQCLGAICGAGVVKGFQPKPYERLGGGANVVSDGYSKGDGLGAEIVGTFILVYTVFSATDAKRSARDSHVPILAPLPI
GFAVFLVHLATIPITGTGINPARSLGAAIIFNKDKAWDDHWIFWVGPFIGAALAALYHQV

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: Passive Transport of Anions out of Vesicles by Aquaporin-6 (REACT_79379), Passive Transport of Anions into Vesicles by Aquaporin-6 (REACT_82075).

biological_process: water transport, transmembrane transport.

REACTOME_PATHWAY: Transmembrane transport of small molecules (REACT_81024), Aquaporin-mediated transport (REACT_101266), Passive Transport by Aquaporins (REACT_94824).

These properties come from blast2go analysis

molecular_function: transporter activity.

cellular_component: integral to membrane, plasma membrane.

biological_process: transmembrane transport.

Locations

Located in CM3.5_contig35754 from 130 to 752.

This polypeptide in other databases

In PhylomeDB is Phy003LMMN_CUCME .

Related features