Polypeptide MELO3C000794P1
Accession: MELO3C000794P1
Name: MELO3C000794P1
Description: Similar to ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P31542|CLPAB_SOLLC)
Sequence:
>MELO3C000794P1 Similar to ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P31542|CLPAB_SOLLC) VIILDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGVGAAEGAIDATNILKPALARGELQ
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleoside-triphosphatase activity, peptidase activity, ATP binding, protein binding, nuclease activity, DNA binding.
cellular_component: chloroplast stroma, chloroplast thylakoid membrane, cell wall.
biological_process: protein metabolic process, nucleotide-excision repair.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003LJSV_CUCME .
