Polypeptide MELO3C000794P1

Accession: MELO3C000794P1

Name: MELO3C000794P1

Description: Similar to ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P31542|CLPAB_SOLLC)

Sequence:

>MELO3C000794P1 Similar to ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P31542|CLPAB_SOLLC)
VIILDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGVGAAEGAIDATNILKPALARGELQ

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: nucleoside-triphosphatase activity, peptidase activity, ATP binding, protein binding, nuclease activity, DNA binding.

cellular_component: chloroplast stroma, chloroplast thylakoid membrane, cell wall.

biological_process: protein metabolic process, nucleotide-excision repair.

Partial gene: true

Locations

Located in CM3.5_contig35868 from 323 to 538.

This polypeptide in other databases

In PhylomeDB is Phy003LJSV_CUCME .

Related features